PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna15391.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 283aa    MW: 32045.8 Da    PI: 4.9201
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna15391.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd+ l+d +k +G  +W++I++  g++R++k+c++rw++yl
  mrna15391.1-v1.0-hybrid 14 KGPWTAEEDKMLADHIKAHGDQNWSSIPKQTGLRRCGKSCRLRWLNYL 61
                             79********************************************97 PP

2Myb_DNA-binding54.92e-1767112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+ T+eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  mrna15391.1-v1.0-hybrid  67 RGNITQEEEDLIIRLHKLLGNR-WSLIAGRIP-GRTDNEIKNYWNSHL 112
                              7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.776961IPR017930Myb domain
SuperFamilySSF466895.24E-3012108IPR009057Homeodomain-like
SMARTSM007174.1E-141363IPR001005SANT/Myb domain
PfamPF002492.2E-161461IPR001005SANT/Myb domain
CDDcd001672.94E-101661No hitNo description
PROSITE profilePS5129425.20262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2565115IPR009057Homeodomain-like
SMARTSM007171.2E-1466114IPR001005SANT/Myb domain
PfamPF002491.2E-1567112IPR001005SANT/Myb domain
CDDcd001671.59E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGRRPCCSKE GVNKGPWTAE EDKMLADHIK AHGDQNWSSI PKQTGLRRCG KSCRLRWLNY  60
LRPNIKRGNI TQEEEDLIIR LHKLLGNRWS LIAGRIPGRT DNEIKNYWNS HLCKKSVEPE  120
MSEAAAKNMR LSVDEAKVED HYHSLDSKMV PESSEGSLLS HSSTTSTTTE ESSSDILMDF  180
YTREISLSEF LDTDFTKFSS MISSGKVTMF HGEGAEQIQK QLPYNSSSQA EANEEAPMNV  240
VISREVVDNL MSWEDQSDSD FGYQLSAAFT DFVAVEEEYW IL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-291211525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004305613.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLM5XNX74e-83M5XNX7_PRUPE; Uncharacterized protein
STRINGVIT_04s0008g01810.t016e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.23e-59myb domain protein 9